DPCstruct | MC9542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Standard deviation of domain lengths | 14.24 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448MIZ8 | 46-166 | AEAVIIEEYQDLQIEDFIDRLNNKALVKKPKGYNYQISKYVKSNLGKATVLDHDVNRPGNVAEDFAEALNYFYKVHSNINKDPSTWG… |
| A0A483MHL7 | 1-115 | MPVYFDFQVLDFIERLHSAENKVVLSAGNKKIKDFIKSNFGRAVVLDHSVNRPGYVAPDFSKAIENFHKNNPTVSLDPQTWGNESAS… |
| A0A1H0YW38 | 2-128 | None |
| A0A643FZ56 | 2-148 | None |
| A0A819C5Y8 | 131-238 | None |
| A0A3G6RVN5 | 92-239 | None |
| A0A511YSR0 | 1-109 | None |
| A0A7S9WS77 | 874-986 | None |
| A0A7S9RGG4 | 1129-1248 | None |
| H5WNZ4 | 297-422 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.