DPCstruct | MC9541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 351 ± 36 aa |
| Standard deviation of domain lengths | 36.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.49 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0023- PF15935- PF19417- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S0F884 | 125-509 | LMVVCNSYYYDKCELLNGDIITVVETSNDIISQSAPIWTEKNGRKVKEIITLDFREISFQVEDGNIYKRYIIDTLLQNKRPSLTIDE… |
| A0A483K447 | 8-361 | SLGFRNDYGEPFFFEAKIVENLLYNDQPTLSSDEHKALYVHFLNRHPELRRKGNEQKLRIALLQDPYFNAFKLKFGYSITGHKAQGS… |
| A0A3M2ETZ0 | 543-909 | None |
| R7ILR1 | 28-407 | None |
| G7F7Q8 | 584-935 | None |
| A0A7V4J1R5 | 3-287 | None |
| A0A6N6KZ87 | 263-598 | None |
| A0A0H2SRF0 | 290-622 | None |
| A0A1D2R1M7 | 205-571 | None |
| R7MKU9 | 8-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.