DPCstruct | MC954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 183 ± 24 aa |
| Standard deviation of domain lengths | 24.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4J3W6 | 7-181 | GSWICAIFDEVALEGLQGVTLPYLWELLERRLCGPSSPLPDRVREQAWALLLRSQPQKVEFFELPEPQPFLPYYDRQNDIDPESGIP… |
| A0A6I9NKM7 | 4-185 | LTIVVDEVALEGLDGITIPSLWIRLENRKPAFPLKLDDHTKELVWRSLINNTELKLYQLPQERDDVVLFDRFKGIDPETGIETRHNF… |
| A0A2A9PBC7 | 1-229 | None |
| A2Y7M9 | 2-266 | None |
| A0A6F9C694 | 1-163 | None |
| A0A821T4P2 | 6-180 | None |
| K1PLS3 | 3-191 | None |
| Q9UST7 | 1-182 | None |
| A0A183R096 | 1-175 | None |
| A0A834MK60 | 96-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.