DPCstruct | MC9538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 108 ± 16 aa |
| Standard deviation of domain lengths | 16.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 20.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0A067 | 1-101 | MPDDAQRFSFEERISYLKEYGSHCMSFSALQPGIQYFDMPGKGYIAYEQKWGRRAVLSDPVCHVKDQETLIAEFLRSGGPTGFAQVS… |
| A0A6H0UG08 | 12-114 | GTELDETVALDILTTYGGNTQSQLLFMGDKRMWVYDNRLVIQFAIRQDKVLVMGTPSGDHSCLLEALTAFIQESDRLGYRPVFYEID… |
| A0A858RQ41 | 496-597 | None |
| A0A0R2JP46 | 366-460 | None |
| A0A2P6NI51 | 295-393 | None |
| A0A0N1NGP7 | 209-304 | None |
| A0A535ZAY0 | 215-339 | None |
| A0A7K3WCM3 | 572-667 | None |
| A0A0K2MFE6 | 10-97 | None |
| A0A1I3PYI4 | 2-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.