DPCstruct | MC9534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 397 ± 109 aa |
| Standard deviation of domain lengths | 108.76 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 79.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.19 |
| Pfam Score | 99.42 |
| Assigned Pfam label(s) | PF04727- PF03999 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0V515 | 11-406 | ANSLFTDINTTKNELLGIWDEMALTEEQRTIRLKDSETYVASERDQVVRIRNTIAKYLAKSEALRSELGIDDSYERNIPAGLVPQAN… |
| A0A287ULR4 | 2-257 | LVWDEVGESDEDRDKVLFQLDQECLDVYKRKVDQALKSRDLLLQALDYSKMELARLASALGEKSIATSPEKTARTIKQQLAALAPTL… |
| J4UBF2 | 39-613 | None |
| A0A0V0J7K0 | 5-455 | None |
| A0A7R8X587 | 56-567 | None |
| A0A811MHC8 | 144-469 | None |
| A0A7R9Q1J7 | 366-670 | None |
| A0A5D2TA90 | 18-519 | None |
| A0A1I8IVD6 | 18-388 | None |
| A0A3Q0IK45 | 18-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.