DPCstruct | MC9530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 13.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8Y1T9 | 46-145 | FNPNHLTKIAVYFSWIVLLLFAYLRETLRLLGLENNKFGKERPEQQDFVPLYSDFESVYSRNCYNRVRDVFERPIASAPSSTVDLLD… |
| A0A6G0UXB9 | 16-136 | KHVVYKADDNYVFKRGHYSTKSYEEASFFVELVVKFQFYVLVFFAILSAVLRKIGILKTFYPLERSEQAHFTELKNTMETIYINKIY… |
| A0A2B4SBA2 | 257-376 | None |
| A0A7R9KCR6 | 699-833 | None |
| A0A0B7MVU3 | 114-207 | None |
| A0A4S8IYS2 | 1-93 | None |
| A0A5A7RB23 | 10-96 | None |
| A0A3Q2Q9Q4 | 62-166 | None |
| A0A6F8ZLN2 | 58-145 | None |
| A0A498IRW1 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.