DPCstruct | MC953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 9.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 35.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0276 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150G7H8 | 34-136 | EQEGNYMIAFARPSEALEWCLMLQEIMMEVAWSPPMLSLPSMHEELHPLTGAVLFRGPRIKAGMYQGVPTKVSPHSTTGRADYFGPL… |
| A0A5J4XPD6 | 585-677 | FASGTDALQFCVVAQEVLLDTAWSQDALAFEQWKAILGKDATVAFRGPRVKMSIVQDIPTSIGPHPDTGCAMYHGPMAGSAAKLCHF… |
| A0A0D2MLA2 | 1162-1254 | None |
| C1GRJ7 | 1678-1767 | None |
| F0UIX7 | 423-512 | None |
| A0A7S1JDU0 | 16-92 | None |
| A0A250XF49 | 37-142 | None |
| A0A0D2LM00 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.