DPCstruct | MC9529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 150 ± 19 aa |
| Standard deviation of domain lengths | 19.00 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.47 |
| Pfam Score | 99.12 |
| Assigned Pfam label(s) | CL0029- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0UVA9 | 723-887 | LFYWNVPSTLCKNENVLNPEDYDIVTNTNQTFLGDKILTFYESNLGLYPRLVILNSTGEEDYIDDSDPETNSAVVKVINGGIPQKTN… |
| L5LLQ6 | 16-153 | NVTIFYVDRLGYYPWYTSQGAPVNGGLPQNTSLQVHLQKVDQDINYYIPAKDFSGLAVIDWEHWRPQWARNWGEKNVYRQKSRKLAS… |
| A0A482WI35 | 12-198 | None |
| A0A5E4Q399 | 254-373 | None |
| A0A835P1S7 | 29-175 | None |
| A0A0N4ZKW9 | 27-177 | None |
| A0A0D6LQA9 | 74-247 | None |
| A0A0N4ZA96 | 3-161 | None |
| A0A0N4Z8H8 | 414-624 | None |
| U5EUF4 | 13-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.