DPCstruct | MC9528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 645 |
|---|---|
| Mean domain length (aa) | 195 ± 38 aa |
| Standard deviation of domain lengths | 38.09 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 13.47 |
| Pfam Score | 91.13 |
| Assigned Pfam label(s) | CL0214- CL0028- PF06074- CL0247- CL0007 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C6FMI3 | 664-854 | RHPRVVSLVLPVPQASLAAAPAFAALERELRASPLAGKIAWDVAARRADRLHATLCGSLAVGSDAEPSLTDGQRAALAALGPVAVEL… |
| A0A6G0UUU7 | 29-223 | TDPENVDEAFVSVRITNRQIETQVSFVQKALVPLDPRFVSTLVPLNFLHLTFNFFNISESNFEKAKKSLEISAESYVWHFGDFNLSF… |
| A0A7W5FI84 | 2-115 | None |
| A0A2M8Q2S0 | 62-267 | None |
| A0A7G8BI87 | 2-178 | None |
| A0A645BZ55 | 163-303 | None |
| A0A2R6C6U6 | 3-177 | None |
| V5B5P9 | 93-343 | None |
| A0A835XZ24 | 37-257 | None |
| A0A1F2YAG2 | 5-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.