DPCstruct | MC9525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 342 ± 80 aa |
| Standard deviation of domain lengths | 80.31 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 67.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.16 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 19.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05217 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1BYB5 | 1-206 | MSEYTAQYHPHCPERTQPLVPPSNIFASGDPMSNRTTQRSDFVEHPYIHPYRYEPAPYKAPEGRIENTTLYQNEFTQKDCPPVKSIK… |
| A0A6G0UGS7 | 99-417 | VASPSNGVDEKCICELCECGNHKCPHNNGRLIGEDGVPVGQTEYESKYIEKPGERAAPFRPGRGTLANEGEMAQDTTHLADYKPWSA… |
| A0A2T7P0S2 | 1-294 | None |
| A0A0L7QKX8 | 55-448 | None |
| A0A0L7QM52 | 1-401 | None |
| A0A195BBQ5 | 1-287 | None |
| D8SA62 | 15-315 | None |
| A0A564Y8D0 | 4-354 | None |
| A0A3Q0JDK9 | 20-320 | None |
| A0A7M3RVE3 | 1-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.