DPCstruct | MC9522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 170 ± 21 aa |
| Standard deviation of domain lengths | 21.19 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W1BT39 | 8-167 | SLVISSPNIKYTDEYIYSDYEYEETLVTRNGDEVTARPIRKTLNIRTDRRVGKVGVMLVGWGGNNGSTFTAAVLANRHQLSWNTKNG… |
| A0A6G0UDM6 | 21-178 | LEVNSSEIKNDGDVLFSNFEYRRNEVKSTPNGVSVTPKRHQYRFQTTLKPKKTGLLLVGLGGNNGSTVVGATIANREKMSWNTRNGV… |
| A0A5N6JQY7 | 19-211 | None |
| A0A7S2RU51 | 21-212 | None |
| F4PXY4 | 8-167 | None |
| W9IV97 | 30-220 | None |
| A0A1E3P9Q2 | 3-161 | None |
| A0A0A1TH78 | 17-212 | None |
| A0A182YLA1 | 298-483 | None |
| A0A7G2CD89 | 1-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.