DPCstruct | MC952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 73 ± 2 aa |
| Standard deviation of domain lengths | 1.59 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 77.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 84.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2RDZ0 | 5-75 | SLKCGDCGALLKSVEEAQEHAELTSHSNFSESTEAVLNLVCSSCGKPCRSKIESDLHTKRTGHTEFIDKTL |
| A0A6P6AAN8 | 4-76 | VSLKCGDCGALLKSVEEAQEHAELTSHSNFSESTEAVLNLVCSACGKPCRSKTESDLHTKRTGHTEFVDRTLE |
| A0A314XM57 | 3-75 | None |
| A0A7N2R6G0 | 3-78 | None |
| A0A2G5C3A6 | 3-77 | None |
| A0A7J0EA62 | 2-75 | None |
| A0A1D6Q273 | 5-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.