DPCstruct | MC9519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 6.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 45.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0DHB7 | 4-90 | DQAPPTLMQLARQRLLREEDLTISILEDLPVGLLPEMFEEAFNDRRTNILRAMVSAWPFPGLSAGALIKDSDLETLKALLAGLDVLI |
| B1AUV7 | 3-93 | TYNPPTLLQLALDGVLRKDSIDFSDLEYLPITLFPPLFIKAFNSRHTEIVKKMVATWPFPCLPVGTLLKTAGVEMLQAVLDGIDILL… |
| A0A5F9D8S6 | 16-106 | None |
| A0A3L7GW18 | 1-94 | None |
| L5M8L8 | 3-92 | None |
| A0A4W2FVG1 | 20-112 | None |
| A0A452UZV8 | 1-110 | None |
| A6PWB4 | 18-107 | None |
| B1AWY9 | 18-107 | None |
| S7MXQ8 | 102-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.