DPCstruct | MC9518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 126 ± 11 aa |
| Standard deviation of domain lengths | 10.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 47.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3T1U8 | 60-182 | KGKAWMVRRSYEEFRTLDAHLHQCIYDRRYSQLLPLLAPSEIGDKLEMLYPLLSEYLSRLSVIVDNKLNCGPVLTWMEIDNHGNRFL… |
| A0A6J0D0E2 | 1-118 | GKSWIVKRSYEDFRVLDKHLHLCIYDRRFSQLSELPRSDMLKDSPESVTQMLMAYLSRLSTIAGNKINCGPALTWMEIDNKGNHLLV… |
| A0A182SAG6 | 84-217 | None |
| A0A067RID3 | 103-224 | None |
| A0A158PHS8 | 70-180 | None |
| A0A1S3RYH0 | 90-212 | None |
| A0A336KSC0 | 76-193 | None |
| A0A158Q5S0 | 1-140 | None |
| A0A3Q0HC30 | 138-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.