DPCstruct | MC9516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 223 ± 29 aa |
| Standard deviation of domain lengths | 28.80 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 49.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09728 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2VSL5 | 5-177 | IANEKTVSLSAEASLIMQALNELSSPEEKLEALVRKYAELVRKQLKFLQKLSVVLEERQQLQAEYRSSIAARSKLESLCREQQSFYN… |
| A0A6J0CWJ6 | 84-334 | EGSDFITKNRNLVSSAFHAQESREEIPGQEARTGPPDGQQDSECSRNKEKTLGKEVLLLMQALNTLSTPEEKLAALCKKYADLLEES… |
| A0A194PWS3 | 1-240 | None |
| A0A673ZCB9 | 52-290 | None |
| A0A2I0TVJ7 | 104-276 | None |
| A0A2K5K187 | 7-213 | None |
| A0A7J8AXH9 | 11-212 | None |
| A0A3B3QV17 | 104-342 | None |
| A0A834NCD4 | 1-303 | None |
| A0A1S3MT54 | 29-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.