DPCstruct | MC9515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 234 ± 13 aa |
| Standard deviation of domain lengths | 13.11 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15865 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0CVV4 | 1-258 | MARAFESYHLDSMVTAFLIVRQATLEGPFVFPSYADWFKESFGSSLGYHSCSKKALVFLFKFLSDLVPWEPARYMQVHIFHPPLVPS… |
| A0A8B6FSZ6 | 275-512 | KMAFEESRTDHILKVFLICRQCCFEGSHVFHSYQDWFLNLFGDSQRSLANSKKTFTCLMKVLTDLVPYDQPSCLKVHILRPPFVPSK… |
| A0A1X2HCB9 | 1-221 | None |
| A0A5N5NWS3 | 75-318 | None |
| A0A1X2G967 | 130-360 | None |
| A0A2G4SH21 | 266-479 | None |
| A0A068S835 | 300-524 | None |
| A0A553Q7D0 | 479-717 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.