DPCstruct | MC9514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 185 ± 29 aa |
| Standard deviation of domain lengths | 29.30 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 65.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 74.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05758 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H0DJT1 | 16-188 | MKIINSVVVVGLYYGFLTTFSIGPSYLFLLRAHVMEEGTEKKVSATTGFITGQLIMFISIYYAPLHLALGRPHTITVLALPYLLFHF… |
| A0A7H0DI78 | 2-203 | SSILDKLVFLGMKISNSVVGVGLYYGFMTIVSIGPAYFFLFRTQVMEERTETKEAAINGFFTGQFVVFISIFYTPLYLALGVSHTII… |
| A0A4S8I1Z4 | 3-147 | None |
| A0A411JTU2 | 1-193 | None |
| A0A499PA15 | 16-207 | None |
| A0A6H1YJL3 | 1-161 | None |
| A0A411K0A6 | 1-196 | None |
| A0A7G9IWZ2 | 32-229 | None |
| A0A7H0ZWB4 | 3-200 | None |
| A0A898CVN9 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.