DPCstruct | MC9512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 158 ± 34 aa |
| Standard deviation of domain lengths | 34.24 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1R485 | 15-155 | EPLERHPSVNQAYEKHRDAYLARKKTAEAVIFEDVFGLDEKQARQCSENGCELGYRLTINRFPYWLEDGIAHLLLFSSQSVWDEAVL… |
| A0A835SSB8 | 7-168 | KARHTWEELQKIINSKDPEALGILGRSQEQLDTYLKRRAEILKEWASAGDNLRFRLFGSPTKLNEDGQLVVDADNDHTAHECHIMVM… |
| A0A0V0QJD6 | 45-190 | None |
| A0A1V8SHD4 | 32-221 | None |
| A0A1V8SBC7 | 89-281 | None |
| A0A7S2JTK4 | 258-410 | None |
| M9LSD6 | 2-246 | None |
| A0A0V0QXZ9 | 17-164 | None |
| L1JXZ8 | 321-447 | None |
| L8GGN2 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.