DPCstruct | MC9509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 214 ± 44 aa |
| Standard deviation of domain lengths | 44.40 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2GQZ8 | 3-228 | SLLMPHAEPFVVRSVERVADRLDDDVRPAALAYARQERQHHAQHRRFNDRVFAAHPRLMWLDRWMDRTFRFLDRRSDDFGVAFSAGF… |
| A0A1Y1R2D8 | 20-219 | FIAQEAVHGHEHDKYNNLLREQGYDIDKLDRHLGFWTRLGQKLMTRKQQLATTCAVEHFTAIMANALMRYPQDWLGDAPDAMKAVWR… |
| A0A538QLK6 | 237-521 | None |
| A0A2K9LKA1 | 27-298 | None |
| A0A6N6XDW9 | 5-189 | None |
| A0A7X2IUG6 | 8-254 | None |
| A0A841MK83 | 8-185 | None |
| A0A418WH50 | 305-569 | None |
| A0A3D4UBQ9 | 43-273 | None |
| A0A834MDI3 | 1-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.