DPCstruct | MC9508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 152 ± 17 aa |
| Standard deviation of domain lengths | 17.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1R0Q0 | 4-189 | YIPNPNALVLSVQGGYDAPAAANVVLDVPSPDAAQTFVSGTVLLNGEPVDKEIVVVSFRQQQRQGQLPERTIITSGQSGTDGRFEID… |
| A0A2E7EB92 | 107-242 | GSGEAKTFTGSVQIQGKGVSRRVVAVALDAEPPYLLAQTQSDTNGSYTLDWQGYSGQMLVTALDDYGTDFVAGMTLGVGDRVHPPYP… |
| A0A2E2DFB0 | 270-407 | None |
| A0A1B1C3B6 | 269-403 | None |
| A0A7Y9UYC5 | 369-528 | None |
| A0A2S5ZGA1 | 312-491 | None |
| A0A1B1C3E4 | 2-136 | None |
| A0A1B1C3B4 | 23-193 | None |
| A0A550FWG7 | 149-301 | None |
| A0A0J7JAV7 | 3-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.