DPCstruct | MC9507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 151 ± 18 aa |
| Standard deviation of domain lengths | 18.14 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446LNH5 | 74-236 | LAKLAQQLVQAGCQQQCAEIYSEARASALESSLKNLGVEKLSKDEVQKMPWEILESKIGNWIHFMRIAVKLLFAGERQLCDQVFQCS… |
| A0A834D4X2 | 18-145 | KECVSIYKIIRQSIVDEGVYHLGVEKLSSSQLNKMDWEVLESKIKNWLDTVKISMRTLFTGEKILCDHVFASSDSIRESCFTEISKQ… |
| A0A1U7Y298 | 3-145 | None |
| A0A2C9VJN6 | 812-976 | None |
| A0A3N7I0K6 | 2-180 | None |
| A0A453DI11 | 3-124 | None |
| A0A444YBA6 | 509-672 | None |
| A0A251SKY0 | 2-156 | None |
| A0A6S7Q0Z3 | 5-146 | None |
| A0A0P0WGJ1 | 134-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.