DPCstruct | MC9505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 4.58 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20120 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A7N1A4 | 7-87 | VDGNAVAGAFSDVLGFDVTSAMLTCTGCGRVAPFAEGHVYQRAPGIVVRCRDCGIVLARLVETLTDVWLDLGGAQNWRIHK |
| A0A4Q7PKP3 | 9-87 | AGDLADVFGRDVTLAIATCAGCGARAVVARSMAYVTDMGSVLRCADCDSVLAVVVGTRDGVNFSMTGIASLRMPNGAHP |
| A0A1G7NQ38 | 50-129 | None |
| A0A1T4PNS9 | 12-88 | None |
| A0A7S7TIT5 | 18-88 | None |
| A0A5F0D7I1 | 4-72 | None |
| A0A5B8C3C0 | 19-99 | None |
| A0A6L3VFP9 | 3-71 | None |
| A0A3A9VUN0 | 2-76 | None |
| A0A538F7V0 | 10-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.