DPCstruct | MC9503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 122 ± 10 aa |
| Standard deviation of domain lengths | 9.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14420 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5YN66 | 1-119 | MVYDWDRHQQTCYRLYIEEGRSLEHIMAHMKTAHDFAPSKRAFQIQFKRWNFPPKQRPAHKNDRLVARVKELWERNLAQPEMLRVLN… |
| A0A1R3RLN1 | 1-115 | MPRSIDLEPYKAEIISLFRNNTTSLDIALHLQQTHHLQVRERTIKARLSSWGVSKRNRTATSNTQLHTRISELFINQGLEERELLQV… |
| A0A1Q5U6X0 | 1-113 | None |
| G7Y198 | 1-116 | None |
| A0A0P7B8G1 | 57-195 | None |
| J3NRW7 | 1-125 | None |
| A0A3N4J441 | 4-124 | None |
| A0A4S9LXL6 | 1-123 | None |
| A0A2U3DPN6 | 39-159 | None |
| A0A0F9XGT8 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.