DPCstruct | MC9502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 348 ± 52 aa |
| Standard deviation of domain lengths | 52.41 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 50.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5YVS4 | 29-475 | RKSGGSPRGAPVTSASSSLIICRNKHWRHISSFHGAWLQIPTEILETIANINYNTLRPRPIDPAILFDLIKIRKNVDEAADLAVRAA… |
| R0IP92 | 47-336 | VHWRYISSFHGPWLQLPPEVLESLAHSNYLSPRPHPIDPAVFYDLVKIRKAVDEATTLAVRATSGLTSAALSNSLHGANSMLGSAAA… |
| A0A6A5ZTP8 | 449-798 | None |
| R1G520 | 1-306 | None |
| E4ZRD9 | 194-533 | None |
| A0A0L6X476 | 52-391 | None |
| A0A1V8TWP4 | 335-613 | None |
| A0A395MZ59 | 553-878 | None |
| A0A5C6GEB1 | 211-523 | None |
| A0A420HFF6 | 6-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.