DPCstruct | MC9501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 129 ± 19 aa |
| Standard deviation of domain lengths | 19.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0KZ10 | 291-425 | LILTLTITASSATPEVRPNTKGFSVTTKRRDPALLAANMVTRMLWFLRPEAFPWDKDQDTVLRVSEMTKKIEHKGVNNRMLRELGWI… |
| R0IL61 | 25-152 | SAGPKKDSSMFTASLVTRMLWSLRPEAFPWDTNNGTILRVADMTKKIGTLVEEETSIANGQLEHKGVSNRLLRELGWIKVVQGNRDS… |
| A0A6A6U066 | 777-897 | None |
| A0A1B8A7S2 | 44-182 | None |
| W9NN89 | 19-140 | None |
| A0A3N4J6Y0 | 801-985 | None |
| A0A1B7XQU1 | 41-157 | None |
| A0A0F9ZZ94 | 441-546 | None |
| A0A420QDT4 | 2-101 | None |
| W9Z7W2 | 158-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.