DPCstruct | MC95
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 603 ± 91 aa |
| Standard deviation of domain lengths | 90.95 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 13.83 |
| Pfam Score | 73.39 |
| Assigned Pfam label(s) | PF21013- CL0020- PF09172- PF06448- PF19444 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662YWV2 | 28-582 | LGKGNLAALEKPLILHLNFGKVKSLYSYRKEHAVFKNIKRGLVSLFQLQLSSGRGEEMDVSGKCKVNYQARQNQVTRIKELDSCKTA… |
| A0A6H5ITV8 | 267-1011 | VDRRREELDVHGVCETTYRLHEARRTSLVLRKSKSLATCRQAGKHLSLVQSHAYRSPLARVHALRQPLVASSSECDITIDHNVYERV… |
| K1PY02 | 144-810 | None |
| A0A066S0N5 | 45-651 | None |
| A0A4Y2LD08 | 15-616 | None |
| A0A2H2IZF9 | 2-485 | None |
| A0A7R9B8J5 | 20-593 | None |
| A0A498NTS6 | 130-791 | None |
| A0A5B7CUZ6 | 3-633 | None |
| A0A5K4FCN8 | 95-648 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.