DPCstruct | MC9498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 164 ± 11 aa |
| Standard deviation of domain lengths | 11.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01817 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7X3S6 | 31-194 | AAFEKVIILVDNVLDFSRPVALFEFANNHPIDHPDKEAAFLERVNAKAVEIKLDTEFARLFFADQINASKVVQSAYFALWNRTGLPN… |
| A0A3N8RNP0 | 331-502 | LSTSPSAAVPPGNAPTLSALLDLTAARLRIARQVALSKWDSGKPVEDLSRESAVIADAVKEARANGVSAKLAVHFFTDQIEANKLVQ… |
| A0A3D5JVG8 | 36-208 | None |
| A0A2C6DCB4 | 231-382 | None |
| A0A0H3WZ88 | 44-216 | None |
| A0A534Q9X8 | 453-608 | None |
| A0A2D7DKM5 | 293-452 | None |
| A0A0E3YFC8 | 8-189 | None |
| A0A0A8K6S0 | 2-148 | None |
| A0A2A2MZ32 | 8-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.