DPCstruct | MC9495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 106 ± 20 aa |
| Standard deviation of domain lengths | 19.85 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2DLE5 | 1-67 | MEKQEFQVGDMIYCIDEDYREFEDIVVSVELERDGTICYTGDNGWDFFKEDIGKEIFRTREERSKFL |
| A0A174XHX1 | 37-135 | KEYEDVGLEPDEIRKLAEYRRLEDQKQLVKLPCKVGDIVYGTFAGRVSECFCIGWKYTGGGLYMICMDRENHQNYSFFDFLFGEKWF… |
| A0A3E4YLX9 | 30-139 | None |
| A0A1Y4MII2 | 47-145 | None |
| A0A4R2K833 | 23-116 | None |
| A0A355TLN7 | 87-199 | None |
| A0A3R6TGZ9 | 24-143 | None |
| F0SXF1 | 38-145 | None |
| A0A858MXP3 | 24-135 | None |
| A0A3R6P183 | 5-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.