DPCstruct | MC9494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 176 ± 20 aa |
| Standard deviation of domain lengths | 20.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.80 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833HJD6 | 24-177 | TSLAEAAARERERRRTAEKPIAVINDKNLADFARDQKLTIAQGDPEAPEPEPEGAAPEEQGEEWWRDRGLEIRRRWREAVDSVERLE… |
| A0A1F5C565 | 4-190 | KRLVVLVFLISIVSSLLFPQTLAEIARKERERRAGLKGKKATVITNADLAKLKKKPALETPPAPPAPVTEEVVALEAAPPVAAEPQE… |
| A0A523EBI1 | 21-174 | None |
| A0A7C3MHM3 | 1-180 | None |
| A0A7C3MEK4 | 2-164 | None |
| A0A7C5UXH2 | 17-220 | None |
| A0A2V7YBE7 | 26-176 | None |
| A0A2V8HSX1 | 22-159 | None |
| A0A7X9FW82 | 1-201 | None |
| A0A7X5W5D1 | 16-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.