DPCstruct | MC9493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 7.41 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 24.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E2UUF8 | 1-82 | MSPSVSMADSWSCHYQELTRSVVILYPNEPSRLPCKVYYAKPKENVIPRTLWEAQNEENYCQRKAEAFVDKLESWGWQCALD |
| A0A1D2QU77 | 16-106 | VGPNSEALLSNVSSFDMGYAGYHCTLQQKQREVNIIHHPHPLYVTVCDVTYQKNQQAPQTLWSDQRNASTCEKKAEAIAIRLKDRGW… |
| A0A2D5ZUX7 | 26-112 | None |
| A0A1Y6CJ15 | 19-122 | None |
| A0A2D6NQJ0 | 3-83 | None |
| A0A3B9XH51 | 3-96 | None |
| A0A7D7VM92 | 14-96 | None |
| A0A382DDI6 | 1-100 | None |
| Q1ZUA1 | 4-95 | None |
| A0A661DBG9 | 6-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.