DPCstruct | MC9492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 38.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2QPW1 | 1-65 | MFTTQGDIKIRSIHGRYGPFNIGTLVTDVGTFAVKDELIEEMSEGVFSGTFVISQIDLGHFPCHG |
| A0A380MVZ9 | 4-81 | ETFTIYGTLVIHYVNGRNGLFPIGTLKSAVGTFRVRSKWIANLEDGEYKGQFAISEFSLYSYHVYGENRTTIGILIDE |
| G9ZG34 | 28-90 | None |
| A0A543V4U4 | 1-65 | None |
| A0A7H9W7T9 | 1-78 | None |
| A0A0L6FTE4 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.