DPCstruct | MC949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 126 ± 14 aa |
| Standard deviation of domain lengths | 14.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5EPS5 | 332-461 | DTLWGTLNASILVHGKLERDPTVGACLERAITELRYGTVAVNHWPAIGYAVGSLPWGGHPSATPADIQSGLGWVHNTYMLEGMDKSV… |
| A0A699YW13 | 8-135 | GSVWGTLSCSVLLHPDTQRDWPQQAEQMLHDLEYGTVMVNTWSAIAYPVPHVVWGAFAGQQTLADVGSGMGQINNTHFFDYPQKAVV… |
| A0A2D5H537 | 34-160 | None |
| A0A7S2KYF3 | 199-347 | None |
| A0A7S1F8K1 | 2-106 | None |
| A0A7S1VQQ0 | 1-107 | None |
| A0A849SA92 | 95-230 | None |
| A0A7S4QBH4 | 18-141 | None |
| A0A0G4FQY4 | 687-845 | None |
| A8IJ71 | 185-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.