DPCstruct | MC9488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 190 ± 32 aa |
| Standard deviation of domain lengths | 31.98 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07314 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4XUX6 | 14-188 | LLSPIFLLLAFEQPLFSIFYDAFNIRNILNLQKDRYLDKVKSIIRYFFDSNTYISLEGLSHIEIVHMYDVKNLIKASLFLLIFSAIL… |
| A0A536FFL6 | 39-214 | GPVSLDVMLSWHRAWAAYVTGIGPAQRPGSDAPPIAFGRQIFTEDEYRHMADVRSVFRGAETAAVLALGVLAFRLIRARGDRRAVRL… |
| A0A368UBK3 | 5-214 | None |
| A0A523Z445 | 15-200 | None |
| A0A656HCR3 | 2-183 | None |
| A0A0G1HHE1 | 12-204 | None |
| A0A221Q7B6 | 311-526 | None |
| A0A7X7BQK5 | 1-124 | None |
| A0A7G9LYJ4 | 52-269 | None |
| A0A2W5XP26 | 33-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.