DPCstruct | MC9487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 122 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9WZI6 | 30-158 | DLQDKYLNSKAAKYAFRNNDIATGEAIMQMFYANSVVPGDTFLTALESQCLWYEYEVGQAYYRKGDYLSALHNLLMFNLHHEHNHNE… |
| A0A672KYZ6 | 108-232 | DTADRFINSKCAKYLLKAGLVKEAEEMCAKFTREGASAVENLNEMQCMWFQTECALAYKSMKKYGEALKKCHEIERHFVEITDDQFD… |
| A0A814BPB3 | 434-558 | None |
| A0A2B4RBH8 | 251-375 | None |
| A0A6P5XL48 | 1-111 | None |
| A0A0G2H191 | 904-1030 | None |
| A0A080ZQS6 | 2-117 | None |
| A0A1D6NJQ7 | 321-445 | None |
| A0A3L6DC95 | 234-354 | None |
| A0A3N7EAG3 | 2-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.