DPCstruct | MC9486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 261 ± 36 aa |
| Standard deviation of domain lengths | 36.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0012 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A5DHY0 | 123-310 | ANSIKSAFALSQDSGLNKVYTETITEIQEVRKICSKISLVRQMQTQSFVHHSQMKQPEIETIKEIDIDPISKLSNHDPFHESIQYPV… |
| A0A0A9WKL9 | 27-292 | GPSPLPSIPPELEHGCMAIMRMKVETRTKMPIAEENYDPKTLELPPDDSLTTEILKHNIRLNKHIKEMSCLIKEIDRDPTKIKECPP… |
| A0A835NWS3 | 118-387 | None |
| A0A4S4MBT9 | 272-499 | None |
| A0A6G0YJ08 | 204-510 | None |
| A0A6P3YC03 | 107-337 | None |
| A0A6S7IGT5 | 19-228 | None |
| F2SFD9 | 259-532 | None |
| A0A226EN93 | 321-576 | None |
| C3ZRP4 | 4-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.