DPCstruct | MC9484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 102 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 47.10 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | CL0171- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1A0M1 | 388-485 | QPHQRDVTNLLAAAVQACHDMVPPDAVEPLFKQVVNQFVHDRSRPEAISVGLNVIREICLRMPLLMTEDLLQDLVLYKKSNEKAVSA… |
| A0A0A9W2C2 | 1-103 | MQPSQLHATQLMALSAMCIHRLIPPDAVEPLLRAIANHFISDRSSADAMTVGLNTIREMCKRQPLAMNADLLRDLVEYKNQRGDRGV… |
| A0A2U1J058 | 801-898 | None |
| A0A183HDN4 | 139-239 | None |
| T1HBZ7 | 253-353 | None |
| A0A6I9PU35 | 1-95 | None |
| A0A7S1VB31 | 3-118 | None |
| A0A4Y7KU50 | 216-308 | None |
| A0A835R6H6 | 650-757 | None |
| G5AQ37 | 134-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.