DPCstruct | MC948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 7.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A699YPN8 | 1-80 | MVGGGVLAYTLLGVAWHEATGEAAFLILDPHYTGGEDLRKIQAGSWVAWKRPGDTAAAGGPLFVADAFYNFLCPQRPTAV |
| A0A1S3W4I3 | 297-381 | SQGRELANHFQSEGTPVMIGGGVLAHTILGVAWNEITGQIKFLILDPHYTGAEDLQVIVEKGWCGWKGPDFWNKDAYYNLCLPQR |
| D3BL71 | 966-1050 | None |
| A0A812PT94 | 458-548 | None |
| A0A5F8MQD2 | 44-133 | None |
| G3IGS9 | 1-72 | None |
| A0A7R8WZ08 | 201-275 | None |
| A0A0R3UK97 | 362-446 | None |
| A0A7S2XZD7 | 107-202 | None |
| A0A0S4KRH5 | 454-545 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.