DPCstruct | MC9479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 187 ± 8 aa |
| Standard deviation of domain lengths | 8.14 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 77.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4FJA6 | 315-497 | ARLLCGMARDNRPWRLVPSLSKAIAAAMATAAFGIFYPTMWSMADALSTARLALISFVAISAMVTWLVIDNGLWERGRDRNTREEAF… |
| A0A239NLV4 | 1-187 | MVRANRPWRLVPGLSKALAAALATGAVATVNSTIWSLAEYLSAPRLVIATVGSVGLMIGWLIIDAELWHRSTEVSAEARQRARLYNA… |
| A0A151A2J2 | 4-189 | None |
| A0A5C4U345 | 64-261 | None |
| A0A7V0MN16 | 100-282 | None |
| H0K8E8 | 1-203 | None |
| A0A3E0PRX8 | 41-223 | None |
| A0A097IDJ5 | 133-306 | None |
| A0A6I6G9C2 | 62-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.