DPCstruct | MC9478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 85 ± 5 aa |
| Standard deviation of domain lengths | 5.17 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522MFM3 | 1-89 | MQSFSFRAECAADVQGFRQVCDRRGLVTAWEVHPDTSGLPDVDVELRSTSSLKLLREAVREVADGHVMLQTLRECPLADNSLERDYD… |
| A0A7U2TY08 | 4-86 | KKYKLRAECSNDVVNFLNNIHTQLHSFKFERWKNLPDCQLIFSTELALDEIQYCLLDIEDCHVMAQTVQPYRLYTGNRNYELT |
| A0A5M6DKL5 | 1-80 | None |
| A0A5C7UJ79 | 215-293 | None |
| A0A2S5LA45 | 5-89 | None |
| A0A1S8FWQ0 | 7-96 | None |
| A0A0N8PT87 | 89-169 | None |
| A0A5Y3KU25 | 2-83 | None |
| A0A1B2Z5A1 | 28-114 | None |
| A0A241XRV8 | 98-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.