DPCstruct | MC9477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 100 ± 14 aa |
| Standard deviation of domain lengths | 13.74 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 45.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3WVZ7 | 1-74 | MKKSFLLFVASFGVLCATAQNPFAEYNYTPKIASLSQGKYNETFDNDTLVQIGSILFNTKSKQIVAFIQIDLST |
| A0A7U2NGL4 | 1-112 | MRKLHFLLLFLFAFSVLSAQEKLSKEEKARREKNIQAGNPFAKYGYKAKVATLSKGKYLEFHDLDSIVTIGTSRWHVDNKKIVGDIV… |
| A0A401U4J0 | 1-93 | None |
| A0A316SVI1 | 17-100 | None |
| A0A4S4A342 | 6-117 | None |
| A0A238PSB2 | 1-117 | None |
| A0A1V2CEQ3 | 1-112 | None |
| A0A2N2XV68 | 13-112 | None |
| A0A1B1FWT8 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.