DPCstruct | MC9474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 155 ± 28 aa |
| Standard deviation of domain lengths | 28.03 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 15.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0404 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7JTJ1 | 116-295 | AVLSFLWNDQILPRTNHKLRTLQVDIQRKKPSLTLKEQVINEVVSGQFFLRAARIDGSSNKLKDVTLYDLGNAERRRIIIADSGRMA… |
| A0A1Z5HKN7 | 5-148 | LAPKASEGFKNFRYLYLIGNGKDEMRETNDVYRQISETEFIYVSNFDIEAKTAYNFVFEKFNAEKLVYKISASSIQWNSKEKTYTLL… |
| A0A3N5Q9N7 | 272-449 | None |
| A0A832AUG6 | 63-233 | None |
| A0A523JVQ1 | 154-322 | None |
| A0A2H6HWC1 | 17-149 | None |
| R5BZT4 | 117-279 | None |
| A0A381GTG6 | 118-274 | None |
| A0A4Q2XX64 | 291-451 | None |
| A0A534BTE3 | 128-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.