DPCstruct | MC9471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 154 ± 20 aa |
| Standard deviation of domain lengths | 19.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5RUX3 | 31-171 | VRKALDEIFSELDKTRIPTGFLEEYAVDYIAMDKYDDNQQDTTLISVDVMTYLMKGIRSASVGEKPFGDVDGIISKYKNDKPVAERT… |
| A0A075RRA6 | 1-168 | MKKTILKLQFIAICAFSITAHSQATFTGLKKDYTQSMDSILTYVNKTPITTGILYDRVMSFSSLSMLKENAVITKSNYKNFLQSWSE… |
| A0A4Z0PNS7 | 23-178 | None |
| A0A5M7BHI9 | 4-166 | None |
| A0A316AQU6 | 1-195 | None |
| A0A848J751 | 226-364 | None |
| A0A180F0Q4 | 2-109 | None |
| A0A1F3F3I9 | 8-161 | None |
| A0A5D8YV31 | 14-194 | None |
| A0A1M5CMB4 | 9-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.