DPCstruct | MC947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 148 ± 12 aa |
| Standard deviation of domain lengths | 11.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 53.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1FTZ0 | 130-289 | KKSYSRDLFLFLYALLIIASALTSLKKHHDKSAFSGKAILYLNRHQTEEWKGWMQVLFLMYHYFAAFEIYNAIRVFIAAYVWMTGFG… |
| A0A175YPR4 | 18-157 | GNETITEDDRAVLLEGGGLQPVSPRARSSSCTSHIIRHQTEEWKGWMQVLFLMYHYFAATEFYNAIRVFIAAYVWMTGFGNFSYYYI… |
| A0A453I829 | 143-301 | None |
| A0A2B4RZN3 | 166-315 | None |
| A0A0N0DE95 | 463-591 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.