DPCstruct | MC9467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 97 |
|---|---|
| Mean domain length (aa) | 109 ± 17 aa |
| Standard deviation of domain lengths | 17.03 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0209 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7UEA8 | 244-364 | LPLTVDEFERGLLYAVSACSRNETGGGEGAEFLVQEEFTSDTLRPGQTVTGTYTKKIYRLRSKAPWVLQKLLPPEAFEIHEESWNAY… |
| A0A1D2MGV2 | 368-480 | YKIGQLWSVIESSRRETGGGDGVEILVNEPFENKPLIGNEFPAGQYTKKRYYLQSKLNGFVRTLLPNSAMVLEEAAWNAYPYCRTVI… |
| A0A183NMX7 | 5-107 | None |
| A0A183NQ36 | 8-108 | None |
| A0A0J9T6T0 | 1-153 | None |
| A0A498LI50 | 35-120 | None |
| A0A0R3Q5Y3 | 66-179 | None |
| A0A7N4NN93 | 46-134 | None |
| A0A0R3QFA3 | 35-133 | None |
| A0A1W0A453 | 12-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.