DPCstruct | MC9466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 5.05 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2N374 | 247-331 | PVNHLTWKVIYDETTRTGVAVIQINNPWVESVTDDDILCDDVCDQLSWVNWDTKDIVKGYTYCCTVASFKQKVSYAPELGDIPLL |
| A0A1D2MAD1 | 1-89 | MWKIIYDEKMGTGAAVIEINNPYITNVQSEDIPCPNVCSQLSWVDWDTTDFVRGYTHCCTIESFREVVSYVGNFPQDFPELPRGNIP… |
| A0A7R9EM02 | 1-87 | None |
| A0A6P7FV24 | 699-768 | None |
| A0A7R9AYI7 | 289-375 | None |
| A0A4C1XQU0 | 6-92 | None |
| A0A811WMN7 | 360-449 | None |
| E9I501 | 51-139 | None |
| A0A6L2Q6B2 | 315-396 | None |
| A0A232F642 | 120-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.