DPCstruct | MC9465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 279 ± 77 aa |
| Standard deviation of domain lengths | 77.44 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 72.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.57 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF12024- PF00439 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7V6L8 | 1-259 | MNVINPSSSEKKIITLGDIVGKLEEGTPGLCAPQEHKSNHQIPISYVSYGPFSSFAPQFDSTWATLCERDSRLLLGTYGDRTNVTNA… |
| A0A1D2M636 | 5-243 | RQRPDGSTSLAILTPCSGVLPGTQEQPVVMNVLAGKLTQGTTQLHGSKEEKKNIQRTVKPLYYGAFSSFAPSLDSTFSNLTPTESEL… |
| A0A182T0C9 | 44-356 | None |
| A0A1I7WSA8 | 246-586 | None |
| A0A7R8CFE7 | 457-709 | None |
| D3ZXX7 | 1-406 | None |
| A0A1Y2G1Q5 | 34-272 | None |
| A0A0V1BVV5 | 320-492 | None |
| A0A0K0DIR8 | 110-319 | None |
| A0A6F9BT74 | 22-440 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.