DPCstruct | MC9464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 100 ± 5 aa |
| Standard deviation of domain lengths | 4.92 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0047 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485D624 | 50-147 | GMVLLDDFVSVQNIINASDEFAAVLKKHGITDSKKVITTPLTVGYFDGKDGLKQDSRLLKVVSYLDTGDGNYWAHPIENLVAVVDLE… |
| A0A0A3W3A7 | 119-216 | PPLMIEEFDDLVKIVQEDPDWIAAVKKRGLTDEDIQNIQIDPWSFGYWGDDEKYKGRRLMRGVAFYRKKLTDNGYAHPLEGLVAIVD… |
| Q8GZ62 | 1-97 | None |
| A0A453C746 | 132-237 | None |
| W7X4S9 | 118-215 | None |
| A0A0D9YUD9 | 406-517 | None |
| D7CDM8 | 631-727 | None |
| A0A1S8CBK0 | 269-369 | None |
| A0A4U9CZ64 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.