DPCstruct | MC9463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 124 ± 22 aa |
| Standard deviation of domain lengths | 21.53 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D7NJL8 | 35-123 | FNVDTDSFRAVPGTPFAYWVSDQVRSTFENFQPFERDGRVVRQGLATADDFRFVRAWWEVSANNDKWPGFAKGGKFSPFYADVFLVV… |
| W7Y8S4 | 192-334 | AKGSYIRLSDFKGAQNQAPRTLEAIKNPQCGWFYTANQKDFEKIPEYRLGYWLSGLQIDAFVNHTELKESHPPKAGLSTANNDRFLR… |
| A0A7X9YIK5 | 19-135 | None |
| A0A6N0ZBE6 | 2-140 | None |
| A0A827JAQ0 | 1-139 | None |
| A0A1E3V0A0 | 1-157 | None |
| A0A2W1KSC6 | 8-120 | None |
| A0A328PLU9 | 160-257 | None |
| A0A7X3I5Z0 | 31-141 | None |
| H1D8U2 | 13-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.