DPCstruct | MC9462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 204 ± 30 aa |
| Standard deviation of domain lengths | 30.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534VEA9 | 131-367 | GSFVAVIVYFTLAGRAEYSPAGVRTALVVALGIATAYIWLARRAGELKQFDAGLWALFAAGTVATSAGFRPVASLFERYSPALLFTT… |
| A0A0L8QM42 | 2-198 | NYLRNFAPWFVYAGVSLIGWQWGALAALICSVYLLLKDRRAGVEAGAQILDFGTIVFVLGMTVVAFADPHSSLHDHDSALSTAWLAL… |
| A0A1J5PZG2 | 6-204 | None |
| A0A4Y9MVR8 | 2-192 | None |
| A0A5C5RT50 | 2-178 | None |
| A0A1B7LGS3 | 41-219 | None |
| A0A7S2S3J2 | 59-281 | None |
| A0A2J4GB51 | 7-191 | None |
| A0A2M7JWI0 | 10-205 | None |
| A0A448YV10 | 46-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.