DPCstruct | MC9460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 50 ± 1 aa |
| Standard deviation of domain lengths | 0.98 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 87.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 41.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0451- PF01826 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P4W0M8 | 41-89 | GLVLHGDVCVRSEDCPCTYHDKEYNAGDNIPNDCNSCTCLGGKWVCTEI |
| L5K6K4 | 555-604 | GMVRNSKGNCVFPDDCPCSFGGQEYDQGNVTSVGCNECTCIKGSWNCTQN |
| A0A6J0CV88 | 271-320 | None |
| A0A1S3QKA3 | 157-206 | None |
| A0A4W5KLC3 | 10-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.